General Information

  • ID:  hor000001
  • Uniprot ID:  O62827(22-75)
  • Protein name:  Adrenomedullin
  • Gene name:  ADM
  • Organism:  Bos taurus (Bovine)
  • Family:  Adrenomedullin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031700 adrenomedullin receptor binding
  • GO BP:  GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010460 positive regulation of heart rate; GO:1990410 adrenomedullin receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  YRQSLNNFQGLRSFGCRFGTCTVQKLAHQIYHFTDKDKDGSAPRSKISPQGY
  • Length:  52(22-75)
  • Propeptide:  MKLVPVALLYLGSLAFLGVDTARLDVAAEFRKKWNKWALSRGKRELRESSSYPTGLADVKAGPVQTLIRPQDVKGASRSPQASSPDAARIRVKRYRQSLNNFQGLRSFGCRFGTCTVQKLAHQIYHFTDKDKDGSAPRSKISPQGYGRRRRRSLPEAGLGRTLLQPPEPKLRGAPDSRVHQVLATLRI
  • Signal peptide:  MKLVPVALLYLGSLAFLGVDT
  • Modification:  T52 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent vasodilator peptide;contributes to the regulation of oviductal fluid flow in ampulla;growth-promoting effect;
  • Mechanism:  affect renal function锛歛n endothelial, NO-dependent mechanism
  • Cross BBB:  NA
  • Target:  CALCRL, RAMP2
  • Target Unid:  A6QP74, A6H7J8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  16-21
  • Structure ID:  AF-O62827-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000001_AF2.pdbhor000001_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 686352 Formula: C262H401N79O77S2
Absent amino acids: EMW Common amino acids: GQSFKR
pI: 10.07 Basic residues: 10
Polar residues: 20 Hydrophobic residues: 12
Hydrophobicity: -88.08 Boman Index: -13203
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 46.92
Instability Index: 4605 Extinction Coefficient cystines: 4595
Absorbance 280nm: 90.1

Literature

  • PubMed ID:  9585168
  • Title:  Cloning of Bovine Preproadrenomedullin and Inhibition of Its Basal Expression in Vascular Endothelial Cells by Staurosporine